Cell Biology

Immunogen CDC45-related protein recombinant protein epitope signature tag (PrEST) Application Anti-CDC45L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Cell division cycle 5-like protein is a protein encoded by the CDC5L gene in humans and is mapped to chromosome region 6p21. It contains 16 exons which span ~50kb.

Immunogen Cell division cycle 5-like protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cell division cycle 6 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to cell division cycle 6 Sequence RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM Application All Prestige Antibodies Powered by Atlas Antibodies are developed

CDC7, also known as CDC7-related kinase or HsCdc7/HuCdc7, and encoded by the gene CDC7/CDC7L1, is a critical kinase needed to phosphorylate critical substrates that regulate the G1/S phase transition and DNA replication. CDC7 is a serine-threonine

Cell division cycle 7 kinase (CDC7), a serine/threonine kinase, comprises two or three kinase insert domains and 11 kinase domains. It has a canonical bilobal kinase fold in its structure.

Anti-Cdc7 Kinase antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the DCS-341 hybridoma produced by the fusion of mouse myeloma cells (NS2) and splenocytes from BALB/c mice immunized with full length human Cdc7 kinase. Cell division

Immunogen cell division cycle 73 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 73 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Cell division cycle associated 2 (CDCA2) is expressed in the nucleus. The gene encoding it is localized on human chromosome 8p21.

Immunogen cell division cycle associated 2 recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of all available