-
HPA007047-100UL
Anti-CDH6 antibody produced in rabbit (C15-1446-793)
Price: $879.43List Price: $977.14Immunogen Cadherin-6 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CDH6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested -
HPA007403-100UL
ANTI-CDH6 ANTIBODY PRODUCED IN RABBIT (C15-1446-883)
Price: $977.14List Price: $1,085.71Immunogen cadherin 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA007456-100UL
Anti-CDH6 antibody produced in rabbit (C15-1446-897)
Price: $879.43List Price: $977.14Immunogen Cadherin-6 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA036819-100UL
Anti-CDHR1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cadherin-related family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA012569-100UL
Anti-CDHR2 antibody produced in rabbit (C15-1447-801)
Price: $879.43List Price: $977.14Immunogen Protocadherin-24 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CDHR2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
HPA017053-100UL
Anti-CDHR2 antibody produced in rabbit (C15-1448-666)
Price: $879.43List Price: $977.14Immunogen Protocadherin-24 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA011218-100UL
Anti-CDHR3 antibody produced in rabbit
Price: $977.14List Price: $1,085.71CDHR3 (cadherin-related family member 3) has a high level of expression in the epithelium of airway. Immunogen Cadherin-like protein 28 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA009081-100UL
Anti-CDHR5 antibody produced in rabbit (C15-1447-293)
Price: $879.43List Price: $977.14CDHR5 (cadherin related family member 5) is a protocadherin (PCDH) family member, and is also known as PCDH24. It might be a constituent of enterocyte microvillus. -
HPA009173-100UL
Anti-CDHR5 antibody produced in rabbit (C15-1447-306)
Price: $879.43List Price: $977.14CDHR5 (cadherin related family member 5) is a protocadherin (PCDH) family member, and is also known as PCDH24. It might be a constituent of enterocyte microvillus. -
HPA049352-100UL
Anti-CDIP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA003387-100UL
Anti-CDK1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cell division control protein 2 homolog recombinant protein epitope signature tag (PrEST) Application Anti-CDK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each -
HPA007451-100UL
Anti-CDK10 antibody produced in rabbit (C15-1446-895)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to cyclin dependent kinase 10 Sequence RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK Application All Prestige Antibodies