-
HPA030171-100UL
Anti-CEP162 antibody produced in rabbit (C15-1452-574)
Price: $879.43List Price: $977.14Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA030172-100UL
Anti-CEP162 antibody produced in rabbit (C15-1452-575)
Price: $879.43List Price: $977.14Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA030173-100UL
Anti-CEP162 antibody produced in rabbit (C15-1452-576)
Price: $879.43List Price: $977.14Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA037606-100UL
Anti-CEP164 antibody produced in rabbit (C15-1454-814)
Price: $928.29List Price: $1,031.43Centrosomal protein 164 (CEP164) is a centriole appendage protein encoded by the gene mapped to human chromosome 11q23.3. -
HPA061504-100UL
Anti-CEP164 antibody produced in rabbit (C15-1463-828)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to centrosomal protein 164 Sequence EVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA042151-100UL
Anti-CEP170 antibody produced in rabbit (C15-1457-091)
Price: $928.29List Price: $1,031.43Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045597-100UL
Anti-CEP170 antibody produced in rabbit (C15-1458-576)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to centrosomal protein 170 Sequence KQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA045787-100UL
Anti-CEP170 antibody produced in rabbit (C15-1458-642)
Price: $928.29List Price: $1,031.43Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA039392-100UL
Anti-CEP192 antibody produced in rabbit (C15-1455-709)
Price: $928.29List Price: $1,031.43Immunogen centrosomal protein 192kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040503-100UL
Anti-CEP192 antibody produced in rabbit (C15-1456-231)
Price: $928.29List Price: $1,031.43Centrosomal protein 192 (CEP192) is a 192 kDa protein present in the centrosome. Cep192 is located on human chromosome 18p11. -
HPA064875-100UL
Anti-CEP250 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen centrosomal protein 250kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA041515-100UL
Anti-CEP44 antibody produced in rabbit (C15-1456-745)
Price: $928.29List Price: $1,031.43Immunogen KIAA1712 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most