Cell Biology

Immunogen chromatin modifying protein 4B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen charged multivesicular body protein 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Charged multivesicular body protein 4c recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen charged multivesicular body protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen charged multivesicular body protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the N terminal region of human CHN2 Sequence Synthetic peptide located within the following region: AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK Physical form Purified antibody supplied in 1x PBS

The gene CHN2 (&#946-chimerin) is mapped to human chromosome 7p15.3.

Immunogen chimerin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Cholecystokinin (CCK) belongs to gastrointestinal hormone family is a neuropeptide hormone and neurotransmitter usually present in gastrointestinal (GI) tract and the central nervous system (CNS). CCK functions include enzyme secretion from

Cholecystokinin (CCK) belongs to gastrointestinal hormone family is a neuropeptide hormone and neurotransmitter usually present in gastrointestinal (GI) tract and the central nervous system (CNS). CCK functions include enzyme secretion from

Cholera toxin, the pathogenic agent of cholera, is made of two subunits, A (27 kDa) and B (12 kDa) assembled with the stoichiometry AB5. The B-subunit binds to specific receptors, the monosialogangliosides GM1, located in the membrane of intestinal

Immunogen cysteine and histidine-rich domain (CHORD) containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project