-
HPA065404-100UL
Anti-CHRND antibody produced in rabbit (C15-1464-882)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cholinergic receptor nicotinic delta subunit Sequence GLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
AV13024-100UL
Anti-CHRNG, N-terminal region antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal of human CHRNG. Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT Physical form Purified antibody supplied in 1x PBS buffer -
ABE1010
Anti-Chromobox protein homolog 5 Antibody (C15-1316-839)
Price: $785.14List Price: $872.38Chromobox protein homolog 5, also known as Antigen p25, Heterochromatin protein 1 homolog alpha (HP1 alpha), and encoded by the gene name CBX5 or HP1A is a component of heterochromatin that recognizes and binds histone H3 tails methylated at -
HPA012884-100UL
Anti-CHST10 antibody produced in rabbit (C15-1447-888)
Price: $879.43List Price: $977.14Carbohydrate sulfotransferase 10 (CHST10) belongs to the human natural killer-1 (HNK-1) sulfotransferase gene family. The gene encoding this protein is located on chromosome 2. -
HPA051545-100UL
Anti-CHST10 antibody produced in rabbit (C15-1460-709)
Price: $977.14List Price: $1,085.71Immunogen carbohydrate sulfotransferase 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA052828-100UL
Anti-CHST11 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen carbohydrate (chondroitin 4) sulfotransferase 11 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
HPA041680-100UL
Anti-CHST12 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen carbohydrate (chondroitin 4) sulfotransferase 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA067960-100UL
ANTI-CHST13 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen carbohydrate sulfotransferase 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA057697-100UL
Anti-CHST14 antibody produced in rabbit (C15-1462-735)
Price: $928.29List Price: $1,031.43Immunogen carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA071601-100UL
Anti-CHST14 antibody produced in rabbit (C15-1466-073)
Price: $928.29List Price: $1,031.43Immunogen carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA017584-100UL
Anti-CHST15 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA013620-100UL
Anti-CHST2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most