Cell Biology

Immunogen Recombinant protein corresponding to cholinergic receptor nicotinic delta subunit Sequence GLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Synthetic peptide directed towards the N terminal of human CHRNG. Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT Physical form Purified antibody supplied in 1x PBS buffer

Chromobox protein homolog 5, also known as Antigen p25, Heterochromatin protein 1 homolog alpha (HP1 alpha), and encoded by the gene name CBX5 or HP1A is a component of heterochromatin that recognizes and binds histone H3 tails methylated at

Carbohydrate sulfotransferase 10 (CHST10) belongs to the human natural killer-1 (HNK-1) sulfotransferase gene family. The gene encoding this protein is located on chromosome 2.

Immunogen carbohydrate sulfotransferase 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen carbohydrate (chondroitin 4) sulfotransferase 11 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Immunogen carbohydrate (chondroitin 4) sulfotransferase 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen carbohydrate sulfotransferase 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most