-
HPA003919-100UL
Anti-CHST7 antibody produced in rabbit (C15-1446-105)
Price: $879.43List Price: $977.14Immunogen carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA030503-100UL
ANTI-CHST7 ANTIBODY PRODUCED IN RABBIT (C15-1452-726)
Price: $977.14List Price: $1,085.71Immunogen carbohydrate sulfotransferase 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA048902-100UL
Anti-CHSY1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chondroitin sulfate synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA044612-100UL
Anti-CHSY3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chondroitin sulfate synthase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040976-100UL
Anti-CHTF18 antibody produced in rabbit (C15-1456-455)
Price: $928.29List Price: $1,031.43Immunogen chromosome transmission fidelity factor 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA056209-100UL
Anti-CHTF18 antibody produced in rabbit (C15-1462-274)
Price: $928.29List Price: $1,031.43Immunogen chromosome transmission fidelity factor 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028647-100UL
Anti-CHTOP antibody produced in rabbit (C15-1451-937)
Price: $879.43List Price: $977.14Chromatin target of PRMT1 (CHTOP) is localized to nuclear speckles and possesses a RG-rich domain. The protein is composed of 248 amino acids. -
HPA030540-100UL
Anti-CHTOP antibody produced in rabbit (C15-1452-739)
Price: $879.43List Price: $977.14Immunogen chromatin target of PRMT1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA040072-100UL
Anti-CHURC1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen churchill domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA042413-100UL
Anti-CIB1 antibody produced in rabbit (C15-1457-198)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to calcium and integrin binding 1 Sequence SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA048825-100UL
Anti-CIB1 antibody produced in rabbit (C15-1459-723)
Price: $928.29List Price: $1,031.43Immunogen calcium and integrin binding 1 (calmyrin) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA036131-100UL
Anti-CIB4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen calcium and integrin binding family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive