Cell Biology

Immunogen cornifelin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen cornifelin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

CNGA2 (cyclic nucleotide gated channel &#9452) makes the &#945 subunit of the olfactory and visual cyclic nucleotide-gated (CNG) channels. This channel is a tetrameric protein, and each subunit has six transmembrane regions, which separate the

Immunogen Recombinant protein corresponding to cyclic nucleotide gated channel alpha 3 Sequence FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Cornichon (CNIH) is expressed in a wide range of human tissues with different expression levels. It is found abundantly in the heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood

Immunogen cornichon homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen connector enhancer of kinase suppressor of Ras 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen CNKSR family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene CNN1 (calponin 1) encodes a 34kDa protein that has some sequence similarity with cardiac troponin I and T. It is mainly present in the cytoskeleton and contractile apparatus of differentiated smooth muscle cells.

Immunogen Synthetic peptide directed towards the N terminal region of human CNN2 Biochem/physiol Actions CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could

Immunogen calponin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen calponin 3, acidic Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.