Cell Biology

The gene CNTROB (centrobin) is mapped to human chromosome 17p13. The protein localizes in the centrioles and is also present in the cytoplasm.

Immunogen Uncharacterized protein C1orf31 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Cofilin-1 (UniProt P23528 also known as 18 kDa phosphoprotein, Cofilin non-muscle isoform, p18) is encoded by the CFL1 (also known as CFL) gene (Gene ID 1072) in human. Cofilin-1 (non-muscle cofilin), cofilin-2 (muscle cofilin), and

Immunogen component of oligomeric golgi complex 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen component of oligomeric golgi complex 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to component of oligomeric golgi complex 3 Sequence DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT Application All Prestige Antibodies Powered by Atlas

Component of oligomeric golgi complex 5 (COG5) is a 90kDa protein which is a part of the conserved oligomeric golgi (COG) complex. The gene encoding it is localized on human chromosome 7q31.

Immunogen component of oligomeric golgi complex 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen component of oligomeric golgi complex 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen component of oligomeric golgi complex 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The cohesin subunit SA-2 is a part of the cohesin complex. This complex is comprised of a heterodimer between SMC1 and SMC3 proteins, as well as RAD21 and STAG proteins (STAG1, 2, or 3).

Immunogen collagen, type XI, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the