-
HPA009143-100UL
Anti-COL12A1 antibody produced in rabbit (C15-1447-301)
Price: $879.43List Price: $977.14COL12A1 (collagen type XII ⓫) gene is localized to human chromosome 6q13. It is the α chain of type XII collagen, which in turn, belongs to the fibril-associated collagens with interrupted triple helices (FACIT) family. -
HPA010021-100UL
ANTI-COL12A1 ANTIBODY PRODUCED IN RABBIT (C15-1447-354)
Price: $977.14List Price: $1,085.71Immunogen collagen type XII alpha 1 chain Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA050392-100UL
Anti-COL13A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type XIII, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA023781-100UL
Anti-COL14A1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Collagen alpha-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA017913-100UL
Anti-COL15A1 antibody produced in rabbit (C15-1448-845)
Price: $879.43List Price: $977.14Collagen type 15, α-1 (COL15A1) is a glycoprotein which is expressed in the basement membrane. It is a 1388 amino acid protein. -
HPA017915-100UL
Anti-COL15A1 antibody produced in rabbit (C15-1448-846)
Price: $879.43List Price: $977.14Collagen type 15, ⓫ (COL15A1) is a glycoprotein which is expressed in the basement membrane. It is a 1388 amino acid protein with collagenous and non-collagenous domains. -
HPA043673-100UL
Anti-COL17A1 antibody produced in rabbit (C15-1457-815)
Price: $928.29List Price: $1,031.43COL17A1 (collagen XVII) is a member of the collagen family. It is an essential component of the hemidesmosome structure. -
HPA052963-100UL
Anti-COL17A1 antibody produced in rabbit (C15-1461-191)
Price: $928.29List Price: $1,031.43Immunogen collagen, type XVII, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA030933-100UL
ANTI-COL18A1 ANTIBODY PRODUCED IN RABBIT (C15-1452-903)
Price: $977.14List Price: $1,085.71Immunogen collagen type XVIII alpha 1 chain Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA036104-100UL
Anti-COL18A1 antibody produced in rabbit (C15-1454-172)
Price: $928.29List Price: $1,031.43Immunogen collagen, type XVIII, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA042422-100UL
Anti-COL19A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type XIX, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA008405-100UL
Anti-COL1A1 antibody produced in rabbit (C15-1447-128)
Price: $977.14List Price: $1,085.71Immunogen Collagen alpha-1(I) chain precursor recombinant protein epitope signature tag (PrEST) Sequence NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK Application All Prestige Antibodies