-
Add to Cart The item has been addedHPA011795-100ULAnti-COL1A1 antibody produced in rabbit (C15-1447-646)
Price: $977.14List Price: $1,085.71Collagen type I alpha 1 chain (COL1A1) gene is located on the human chromosome at 17q21.33. -
Add to Cart The item has been addedHPA012111-100ULANTI-COL1A1 ANTIBODY PRODUCED IN RABBIT (C15-1447-735)
Price: $977.14List Price: $1,085.71Immunogen collagen type I alpha 1 chain Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA059738-100ULAnti-COL1A2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type I, alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA051962-100ULAnti-COL20A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type XX, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA031212-100ULAnti-COL21A1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen collagen, type XXI, ⓫ recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA024830-100ULAnti-COL22A1 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene COL22A1 (collagen type XXII α 1 chain) is mapped to human chromosome 8q24.2. -
Add to Cart The item has been addedHPA048471-100ULAnti-COL27A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type XXVII, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043844-100ULAnti-COL28A1 antibody produced in rabbit (C15-1457-901)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to collagen type XXVIII alpha 1 chain Sequence SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA060468-100ULAnti-COL28A1 antibody produced in rabbit (C15-1463-546)
Price: $928.29List Price: $1,031.43Immunogen collagen, type XXVIII, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA007583-100ULAnti-COL3A1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Collagen α-1(III) chain precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA069337-100ULANTI-COL4A2 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen collagen type IV alpha 2 chain Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAV52418-100ULAnti-COL4A3BP antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human COL4A3BP Biochem/physiol Actions COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV
