Cell Biology

Annexin V-FITC kit allows fluorescent detection of annexin V bound to apoptotic cells and quantitative determination by flow cytometry. The AnnexinV-FITC kit uses annexin V conjugated with fluorescein isothiocyante (FITC) to label

Annexin V-FITC kit allows fluorescent detection of annexin V bound to apoptotic cells and quantitative determination by flow cytometry. The AnnexinV-FITC kit uses annexin V conjugated with fluorescein isothiocyante (FITC) to label

14-3-3 protein beta/alpha (KCIP-1, Protein 1054, Protein kinase C inhibitor protein 1), epsilon (14-3-3E), eta (Protein AS1), gamma (KCIP-1, Protein kinase C inhibitor protein 1), theta (14-3-3 protein T-cell, 14-3-3 protein tau, Protein HS1),

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Specificity 14-3-3 Protein, phosphoSerine58. The antibody recognizes a protein of ~29 kDa corresponding to 14-3-3 Protein, phosphoSerine58 in lysates from rat brainstem.

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Immunogen Recombinant protein corresponding to septin 8. Sequence NAFNRRKAAVEALQSQALHATSQQPLRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Tumor protein p53 binding protein (T153BP1) is mapped to human chromosome 15q15.3.

Anti-á-Amyloid42 (FCA3542) Rabbit Antibody, 50UL

Immunogen APOBEC1 complementation factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen alpha-2-macroglobulin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the