-
HPA014295-100UL
Anti-COX6C antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen cytochrome c oxidase subunit VIc Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA059124-100UL
Anti-COX7A2L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cytochrome c oxidase subunit VIIa polypeptide 2 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA003127-100UL
Anti-COX8C antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cytochrome c oxidase polypeptide 8 isoform 3, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA001834-100UL
Anti-CP antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Ceruloplasmin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA021836-100UL
Anti-CPA1 antibody produced in rabbit (C15-1450-014)
Price: $879.43List Price: $977.14Immunogen Carboxypeptidase A1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA052215-100UL
Anti-CPA1 antibody produced in rabbit (C15-1460-945)
Price: $928.29List Price: $1,031.43Immunogen carboxypeptidase A1 (pancreatic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA020342-100UL
Anti-CPA2 antibody produced in rabbit (C15-1449-573)
Price: $879.43List Price: $977.14Carboxypeptidase A2 (CPA2) is formed by the release of the 81-residue activation domain of its proenzyme-procarboxypeptidase A2. Immunogen Carboxypeptidase A2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA021317-100UL
Anti-CPA2 antibody produced in rabbit (C15-1449-829)
Price: $879.43List Price: $977.14The gene CPA2 (carboxypeptidase A2) is mapped to human chromosome 7q32. The protein is secreted by the pancreas in the form of an inactive proenzyme. -
HPA006479-100UL
Anti-CPA3 antibody produced in rabbit (C15-1446-652)
Price: $879.43List Price: $977.14CPA3 (carboxypeptidase A3) forms a major component of mast cell secretory granules. It is a zinc-dependent metalloprotease. -
HPA008689-100UL
Anti-CPA3 antibody produced in rabbit (C15-1447-185)
Price: $879.43List Price: $977.14Immunogen Mast cell carboxypeptidase A precursor recombinant protein epitope signature tag (PrEST) Sequence KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL Application -
HPA020322-100UL
Anti-CPA5 antibody produced in rabbit
Price: $879.43List Price: $977.14Carboxypeptidase A5 (CPA5) is expressed in the germ cells of the testis. The gene encoding it is localized on human chromosome 7q32. -
HPA038069-100UL
Anti-CPB1 antibody produced in rabbit (C15-1455-055)
Price: $928.29List Price: $1,031.43Immunogen carboxypeptidase B1 (tissue) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the