-
HPA063621-100UL
Anti-CPT1C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to carnitine palmitoyltransferase 1C Sequence AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
ABS85
Anti-CPT2 Antibody (C15-1317-939)
Price: $759.43List Price: $843.81Carnitine palmitoyltransferase II (CPT2, or CPT II) belongs to the carnitine/choline acetyltransferase family. It is a ubiquitous protein found in the inner membrane of the mitochondria and plays an essential role in fatty acid β-oxidation. -
HPA028201-100UL
Anti-CPT2 antibody produced in rabbit (C15-1451-746)
Price: $879.43List Price: $977.14Immunogen carnitine palmitoyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028202-100UL
Anti-CPT2 antibody produced in rabbit (C15-1451-747)
Price: $879.43List Price: $977.14Immunogen carnitine palmitoyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028214-100UL
Anti-CPT2 antibody produced in rabbit (C15-1451-752)
Price: $879.43List Price: $977.14Immunogen carnitine palmitoyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA048375-100UL
Anti-CPXM2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen carboxypeptidase X (M14 family), member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA078608-100UL
ANTI-CPZ ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen carboxypeptidase Z Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA042455-100UL
Anti-CR1 antibody produced in rabbit (C15-1457-218)
Price: $928.29List Price: $1,031.43Immunogen complement component (3b/4b) receptor 1 (Knops blood group) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA043579-100UL
Anti-CR1 antibody produced in rabbit (C15-1457-769)
Price: $928.29List Price: $1,031.43Immunogen complement component (3b/4b) receptor 1 (Knops blood group) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA049348-100UL
Anti-CR1 antibody produced in rabbit (C15-1459-904)
Price: $928.29List Price: $1,031.43CR1 (complement receptor type 1) is a member of complement inhibitors family. It is also known as CD35. -
HPA052942-100UL
Anti-CR2 antibody produced in rabbit (C15-1461-186)
Price: $977.14List Price: $1,085.71Immunogen complement component (3d/Epstein Barr virus) receptor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA060715-100UL
Anti-CR2 antibody produced in rabbit (C15-1463-609)
Price: $928.29List Price: $1,031.43Immunogen complement component (3d/Epstein Barr virus) receptor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most