Cell Biology

Immunogen cysteine-rich PDZ-binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen cysteine-rich PDZ-binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen cysteine-rich secretory protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cysteine-rich secretory protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene CRISPLD1 (cysteine rich secretory protein LCCL domain containing 1) is mapped to human chromosome 8q21.11.

Immunogen Recombinant protein corresponding to cysteine rich secretory protein LCCL domain containing 2 Sequence TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK Application All

Immunogen cysteine-rich secretory protein LCCL domain containing 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given

Immunogen v-crk avian sarcoma virus CT10 oncogene homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Crk-like protein (CRKL) is a 39 kDa adaptor protein with one SH2 and two SH3 binding domains. CRKL is the major protein which is tyrosine phosphorylated in response to BCR/ABL (chronic myelogenous leukemia) and growth factor activation.

Immunogen v-crk avian sarcoma virus CT10 oncogene homolog-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Crk-like protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen cytokine receptor-like factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are