-
HPA063619-100UL
ANTI-CRTC1 ANTIBODY PRODUCED IN RABBIT (C15-1464-419)
Price: $977.14List Price: $1,085.71Immunogen CREB regulated transcription coactivator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028454-100UL
Anti-CRTC2 antibody produced in rabbit (C15-1451-848)
Price: $879.43List Price: $977.14Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028465-100UL
Anti-CRTC2 antibody produced in rabbit (C15-1451-855)
Price: $879.43List Price: $977.14CREB-regulated transcription co-activator 2 (CRTC2) is also known as TORC (transducer of regulated CREB). Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA043735-100UL
Anti-CRTC3 antibody produced in rabbit (C15-1457-847)
Price: $928.29List Price: $1,031.43Immunogen CREB regulated transcription coactivator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA063691-100UL
Anti-CRTC3 antibody produced in rabbit (C15-1464-452)
Price: $908.74List Price: $1,009.71Immunogen CREB regulated transcription coactivator 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
C0867-100UG
Anti-CRTH2 (GRP44) antibody produced in rabbit
Price: $1,011.43List Price: $1,123.81Immunogen peptide corresponding to the human CRTH2 (GRP44) protein, near the C-terminus (amino acids 329-348). Application Anti-CRTH2 (GRP44) antibody produced in rabbit is suitable for western blotting at a working dilution of 1:500-1:1,000 using -
HPA036762-100UL
Anti-CRX antibody produced in rabbit (C15-1454-534)
Price: $928.29List Price: $1,031.43Immunogen cone-rod homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA036763-100UL
Anti-CRX antibody produced in rabbit (C15-1454-535)
Price: $928.29List Price: $1,031.43Immunogen cone-rod homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA037577-100UL
Anti-CRY2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cryptochrome circadian clock 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA022016-100UL
Anti-CRYBA1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to crystallin beta A1 Sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA062293-100UL
Anti-CRYBA2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to crystallin beta A2 Sequence GYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA071178-100UL
Anti-CRYBA4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen crystallin, beta A4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the