Cell Biology

AATF/Rb-binding protein Che-1, also known as Protein Apoptosis-antagonizing transcription factor (Protein AATF), Rb-binding protein Che-1, and encoded by the gene name AATF/ CHE1/ DED/ HSPC277, is a member of the AATF family. Recent studies have

AATK (apoptosis-associated tyrosine kinase) was recently identified in 32Dcl3 mouse myeloid cells, which were subjected to IL (interleukin)-3 withdrawal and undergoing apoptosis. This protein is composed of a putative tyrosine kinase domain, and

ABCA10 (ATP-binding cassette, sub-family A (ABC1), member 10) belongs to ABC transporter superfamily. It is a part of the second group of ABCA subfamily, which contains five members located on chromosome 17q24.

Immunogen ATP-binding cassette, sub-family A (ABC1), member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen ATP-binding cassette, sub-family C (CFTR/MRP), member 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ATP binding cassette subfamily C member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family D (ALD), member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family D (ALD), member 3 recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of

Immunogen Recombinant protein corresponding to ABL proto-oncogene 2, non-receptor tyrosine kinase Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF Application All Prestige Antibodies Powered

Immunogen actin binding LIM protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen actin binding LIM protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to activator of basal transcription 1 Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and