Cell Biology

Immunogen catenin (cadherin-associated protein), delta 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Cytidine triphosphate synthetase 2 (CTPS2), mapped to human chromosome Xp22, codes for CTPS 2 enzyme, which is expressed ubiquitously. Cytidine triphosphate synthetase 2 is an isoenzyme of hCTPS.

Immunogen CTP synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Synthetic peptide directed towards the N terminal region of human CTRL Sequence Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS Physical form Purified antibody supplied in 1x PBS

Immunogen chymotrypsin-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen chymotrypsin-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Complement C1q tumor necrosis factor-related protein 3 (CTRP3 or C1QTNF3), also known as Collagenous repeat-containing sequence 26 kDa protein, contains one C1q domain and one collagen-like domain, and may play an important role in skeletal

Immunogen cathepsin E Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Cathepsin S precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen cathepsin Z Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cathepsin Z Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cortactin binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the