Cell Biology

Immunogen Recombinant protein corresponding to cytochrome P450 family 27 subfamily C member 1 Sequence TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen cytochrome P450, family 27, subfamily C, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

CYP2b10 (Cytochrome P450, family 2, subfamily b, polypeptide 10) is a member of the cytochrome P450 superfamily of monooxygenase enzymes which catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other

Immunogen cytochrome P450, family 2, subfamily B, polypeptide 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

CYP2C8 (cytochrome P450, family 2, subfamily C, polypeptide 8) has been found to be expressed in the kidney, adrenal gland, brain, uterus, mammary gland, ovary, and duodenum. The gene is mapped to human chromosome 10q23.

The gene CYP2C8 (cytochrome P450 family 2 subfamily C member 8) encodes a protein belonging to the cytochrome P450 superfamily of enzymes. It is predominantly expressed in the liver and kidney.

CYP2C19 (cytochrome P450, family 2, subfamily C, polypeptide 19) is a member of the cytochrome P450 enzyme family. It is an essential enzyme of phase I metabolism, and is highly expressed in smooth muscle and endothelial cells.

Anti-C&#947P2D6 polyclonal antibody reacts with pig, rabbit, human, mouse, rat, and zebrafish cytochrome P450, family 2, subfamily D, polypeptide 6 proteins. Cytochrome P450, family 2, subfamily D, polypeptide 6 (C&#947P2D6) is an important

Immunogen cytochrome P450, family 2, subfamily D, polypeptide 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

The CYP2E1 (cytochrome P450 2E1) gene is mapped to human chromosome 10 and is polymorphic. CYP2E1 is part of the cytochrome P450 (CYP) family of enzymes.

The gene CYP2E1 (cytochrome P450 2E1) is mapped to human chromosome 10. The CYP2E1 gene is polymorphic.

Immunogen cytochrome P450, family 2, subfamily R, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project