-
HPA035022-100UL
Anti-ABTB1 antibody produced in rabbit (C15-1453-646)
Price: $928.29List Price: $1,031.43Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA035023-100UL
Anti-ABTB1 antibody produced in rabbit (C15-1453-647)
Price: $928.29List Price: $1,031.43Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA020065-100UL
Anti-ABTB2 antibody produced in rabbit (C15-1449-507)
Price: $879.43List Price: $977.14Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) is an adaptor protein for cullin 3 which is an E3-ubiquitin ligase scaffold protein. Immunogen Ankyrin repeat and BTB/POZ domain-containing protein 2 recombinant protein epitope -
HPA030699-100UL
Anti-ABTB2 antibody produced in rabbit (C15-1452-800)
Price: $879.43List Price: $977.14Immunogen ankyrin repeat and BTB (POZ) domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA040755-100UL
Anti-AC004381.6 antibody produced in rabbit (C15-1456-339)
Price: $928.29List Price: $1,031.43Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040868-100UL
Anti-AC004381.6 antibody produced in rabbit (C15-1456-404)
Price: $928.29List Price: $1,031.43Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA006764-100UL
Anti-ACAA1 antibody produced in rabbit (C15-1446-723)
Price: $879.43List Price: $977.14Immunogen 3-Ketoacyl-CoA thiolase, peroxisomal precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA007244-100UL
Anti-ACAA1 antibody produced in rabbit (C15-1446-842)
Price: $879.43List Price: $977.14Immunogen 3-Ketoacyl-CoA thiolase, peroxisomal precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA006554-100UL
Anti-ACACB antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Acetyl-CoA carboxylase 2 recombinant protein epitope signature tag (PrEST) Application Anti-ACACB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
HPA075570-100UL
Anti-ACAP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA034807-100UL
Anti-ACAP2 antibody produced in rabbit (C15-1453-568)
Price: $889.20List Price: $988.00Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA034808-100UL
Anti-ACAP2 antibody produced in rabbit (C15-1453-569)
Price: $889.20List Price: $988.00Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)