Cell Biology

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) is an adaptor protein for cullin 3 which is an E3-ubiquitin ligase scaffold protein. Immunogen Ankyrin repeat and BTB/POZ domain-containing protein 2 recombinant protein epitope

Immunogen ankyrin repeat and BTB (POZ) domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen 3-Ketoacyl-CoA thiolase, peroxisomal precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen 3-Ketoacyl-CoA thiolase, peroxisomal precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Acetyl-CoA carboxylase 2 recombinant protein epitope signature tag (PrEST) Application Anti-ACACB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen Recombinant protein corresponding to ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)