Cell Biology

Immunogen cytochrome P450, family 2, subfamily S, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to cytochrome P450 family 2 subfamily S member 1 Sequence GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL Application All Prestige Antibodies Powered by Atlas

Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Cytochrome P450 2W1 (CYP2W1) is a hemoprotein which belongs to the cytochrome family of proteins. It is located on the cell surface.

Immunogen cytochrome P450, family 3, subfamily A, polypeptide 43 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen cytochrome P450 family 3 subfamily A member 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant CYP450 1A1 Application Research Category Metabolism Research Sub Category Enzymes &amp Biochemistry This Anti-CYP450 1A1 Antibody is validated for use in WB for the detection of CYP450 1A1. Quality Routinely evaluated by

Immunogen Synthetic peptide directed towards the N terminal region of human CYP4A22 Biochem/physiol Actions CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many

CYP4B1 (cytochrome P450, family 4, subfamily B, polypeptide 1) is a member of extra-hepatic CYP450 family highly expressed in the lung. More specifically it is observed in the ciliated sub-mucosal gland ducts as well as in the surface epithelium.

CYP4F11 (cytochrome P450, family 4, subfamily F, polypeptide 11) is a cytochrome P450 4F isoform belonging to the CYP4 family and CYP4A subfamily. In humans, it is expressed in liver, heart, kidney, and skeletal muscles.