Cell Biology

Specificity Crim1 SUBCELLULAR LOCALIZATION: Intracellular and Membrane associated. Immunogen Recombinant protein from the cytoplasmic tail of mouse Crim1.

Immunogen cysteine-rich transmembrane module containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Mitochondrially encoded cytochrome b (MT-CYB CYTB) is encoded by mitochondrial DNA. Immunogen Synthetic peptide directed towards the N terminal region of human CYTB Application Anti-CYTB antibody produced in rabbit is suitable for western blotting

Immunogen Recombinant protein corresponding to cytohesin 2 Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen cytohesin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cytokine like 1 Sequence TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen rabbit cytochrome c Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Target description Cytochrome c is an electron transport

Specificity The rabbit polyclonal serum detects CYP3A4 in humans and rats by sequence homology of the immunogen used, cross reactivity to CYP3A7, 3A6v43A2v1, 3A8, 3A9 may be expected but is untested at this time. Immunogen A synthetic peptide

Specificity This antibody reacts with the suprabasal cells of stratified squamous epithelia in human, murine and porcine species. Immunogen Keratin 1 and 10.

Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues.

Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues.

Specificity Cytokeratin 14, a type I intermediate filament, is one of the two cytokeratins that distinguish stratifying epithelial cell types from simple epithelial cell types. Thus, cytokeratin 14 is expressed by stratifying/keratinocyte cell