Cell Biology

Immunogen DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

DEAF1 is a transcription factor that regulates innate immune responses in Drosophila . It also modulates the expression of tissue antigens in pancreatic lymph nodes of type 1 diabetic mice.

The protein Death-associated protein 1 or also known as DAP-1/DAP1 and encoded by the gene DAP/DAP1 is a negative regulator of autophagy. The link of DAP1 to autophagy was recognized because in DAP1 knockdowns there was enhanced autophagic flux and

Immunogen differentially expressed in FDCP 6 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen differentially expressed in FDCP 6 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen defensin alpha 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Defensin-5 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen defensin, beta 106B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen defensin, beta 108B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Anti-dEGF Receptor, Extracellular Domain antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma C-273 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with a recombinant

Immunogen Recombinant protein corresponding to DENN domain containing 4B Sequence PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

DENND4C (DENN/MADD domain containing 4C) is a member of the DENND4 subfamily of DENND proteins. It resides in the cytosol, and contains the characteristic DENN domain, which acts as the GEF (guanine nucleotide exchange factor) domain.