Cell Biology

Destrin/ADF is usually found in regions containing dynamic actin pools such as the leading edge of migrating cells and neuronal growth cones and may also colocalize in cell nuclei. It is also present in ‘Hirano bodies′ in certain brain neurons

Immunogen Protein DGCR14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Protein DGCR14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

The DGCR2 (DiGeorge syndrome critical region gene 2) gene is mapped to human chromosome 22q11. This region is associated with several developmental defects, including DiGeorge syndrome.

Immunogen DiGeorge syndrome critical region gene 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen diacylglycerol kinase, delta 130kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen diacylglycerol kinase, delta 130kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

DGKI (Diacylglycerol kinase iota) is a small, integral membrane protein belonging to the type IV diacylglycerol kinase subfamily. It is mapped on chromosome 7q32.

Immunogen diacylglycerol kinase, zeta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The protein DGL-alpha is a lipase enzyme that catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG) endocannabinoid in tissues. Endocannabinoids are a group of lipid-like molecules that are neuromodulatory in nature and

Immunogen Recombinant protein corresponding to 24-dehydrocholesterol reductase Sequence SKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPKG Application All

Immunogen 24-dehydrocholesterol reductase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in