Cell Biology

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. Histones are modified post-translationally by the actions of enzymes in both the nucleus and cytoplasm.

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. The histones have an amino terminal tail, a globular domain, and a carboxy-terminal tail.

Specificity ChIP validated Immunogen dimethylated synthetic peptide corresponding to amino acids 22-23 (diMeLys 26 ) of human histone H1.4.

Immunogen DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

DIRAS family GTPase 3 (DIRAS3), also known as aplasia Ras homologue member I (ARHI), is an imprinted tumor suppressor gene. It is expressed in epithelial cells.

Immunogen DIRAS family, GTP-binding RAS-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen disrupted in renal carcinoma 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

DIS3-like protein (DIS3L) is encoded by the gene mapped to human chromosome 15q22.31.

Disrupted in schizophrenia 1 (DISC1) is a candidate gene for susceptibility to schizophrenia. It was discovered through chromosomal analysis of a large Scottish family whose members exhibited schizophrenia and related psychiatric disorders.

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Immunogen Recombinant protein corresponding to disrupted in schizophrenia 1 Sequence LQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIET Application All Prestige Antibodies Powered by