-
HPA017051-100UL
Anti-DNAJB11 antibody produced in rabbit (C15-1448-665)
Price: $879.43List Price: $977.14DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). -
HPA010642-100UL
Anti-DNAJB12 antibody produced in rabbit (C15-1447-413)
Price: $879.43List Price: $977.14DNAJ/HSP40 family of proteins contains a highly conserved, 70 amino acid J domain that is involved in the interaction with HSP70 and regulation of its ATPase activity. It also contains a glycine and phenylalanine (G/F)-rich region that may function -
HPA072702-100UL
ANTI-DNAJB12 ANTIBODY PRODUCED IN RABBIT (C15-1466-269)
Price: $977.14List Price: $1,085.71Immunogen DnaJ heat shock protein family (Hsp40) member B12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA052465-100UL
Anti-DNAJB13 antibody produced in rabbit (C15-1461-028)
Price: $928.29List Price: $1,031.43Immunogen DnaJ (Hsp40) homolog, subfamily B, member 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA061330-100UL
Anti-DNAJB13 antibody produced in rabbit (C15-1463-751)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to DnaJ heat shock protein family (Hsp40) member B13 Sequence WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA036016-100UL
Anti-DNAJB14 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen DnaJ (Hsp40) homolog, subfamily B, member 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA036268-100UL
Anti-DNAJB2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen DnaJ (Hsp40) homolog, subfamily B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028383-100UL
Anti-DNAJB4 antibody produced in rabbit (C15-1451-802)
Price: $879.43List Price: $977.14Immunogen DnaJ (Hsp40) homolog, subfamily B, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028385-100UL
Anti-DNAJB4 antibody produced in rabbit (C15-1451-803)
Price: $879.43List Price: $977.14Immunogen DnaJ (Hsp40) homolog, subfamily B, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA050794-100UL
Anti-DNAJB5 antibody produced in rabbit
Price: $967.37List Price: $1,074.86Immunogen DnaJ (Hsp40) homolog, subfamily B, member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA024258-100UL
Anti-DNAJB6 antibody produced in rabbit (C15-1450-695)
Price: $879.43List Price: $977.14Immunogen DnaJ homolog subfamily B member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA058593-100UL
Anti-DNAJB6 antibody produced in rabbit (C15-1463-000)
Price: $928.29List Price: $1,031.43Immunogen DnaJ (Hsp40) homolog, subfamily B, member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive