Cell Biology

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

DNAJC30 (DnaJ heat shock protein family (Hsp40) member C30) encodes a DNAJ-like chaperone, which may be associated with the Williams-Beuren syndrome (WBS), a developmental disorder. In WBS, deletion of contiguous genes at 7q11.

DNAJC4 (DnaJ (Hsp40) homolog, subfamily C, member 4) is a J domain containing protein belonging to the DnaJ family of proteins. It consists of a membrane-spanning region adjacent to their J domain, gly/phe-rich domain and a loosely conserved

Immunogen DnaJ heat shock protein family (Hsp40) member C5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

DnaJ homolog subfamily C member 5 (DNAJC5) contains an N-terminal J-domain, an adjacent linker region, a cysteine rich domain and a variable C terminus. DNAJC5 is expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and

Immunogen DnaJ homolog subfamily C member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to DnaJ heat shock protein family (Hsp40) member C5 beta Sequence MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 5 gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive