-
F7884-1ML
Anti-Dog IgG (whole molecule)-FITC antibody produced in rabbit (C15-1425-144)
Price: $339.80List Price: $377.55IgG (Immunoglobulin G) antibody subtype is the most abundant serum immunoglobulins of the immune system. It is secreted by B cells and is found in blood and extracellular fluids and provides protection from infections caused by bacteria, fungi and -
F7884-2ML
Anti-Dog IgG (whole molecule)-FITC antibody produced in rabbit (C15-1425-145)
Price: $534.86List Price: $594.29IgG (Immunoglobulin G) antibody subtype is the most abundant serum immunoglobulins of the immune system. It is secreted by B cells and is found in blood and extracellular fluids and provides protection from infections caused by bacteria, fungi and -
A6792-1ML
Anti-Dog IgG (whole molecule)-Peroxidase antibody produced in rabbit (C15-1315-372)
Price: $413.27List Price: $459.18IgG (immunoglobulin G) antibody subtype is the most abundant of serum immunoglobulins of the immune system. It is secreted by B cells and is found in blood and extracellular fluids. -
A9042-2ML
Anti-Dog IgG (whole molecule)-Peroxidase antibody produced in rabbit (C15-1315-506)
Price: $521.14List Price: $579.05Immunoglobulins (Igs) belong to immunoglobulin super-family. IgG is abundant immunoglobulin in proteins in human serum. -
AV09001-100UL
Anti-DOK1 antibody produced in rabbit (C15-1340-543)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human DOK1 Application Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml. -
HPA048561-100UL
Anti-DOK1 antibody produced in rabbit (C15-1459-630)
Price: $928.29List Price: $1,031.43Immunogen docking protein 1, 62kDa (downstream of tyrosine kinase 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA054460-100UL
Anti-DOK5 antibody produced in rabbit (C15-1461-687)
Price: $928.29List Price: $1,031.43Immunogen docking protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA065235-100UL
Anti-DOK5 antibody produced in rabbit (C15-1464-837)
Price: $928.29List Price: $1,031.43Immunogen docking protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA041099-100UL
Anti-DOK6 antibody produced in rabbit (C15-1456-519)
Price: $928.29List Price: $1,031.43Immunogen docking protein 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA063534-100UL
Anti-DOK6 antibody produced in rabbit (C15-1464-385)
Price: $928.29List Price: $1,031.43Immunogen docking protein 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA059449-100UL
Anti-DOK7 antibody produced in rabbit (C15-1463-267)
Price: $928.29List Price: $1,031.43Immunogen docking protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA062780-100UL
Anti-DOK7 antibody produced in rabbit (C15-1464-191)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to docking protein 7 Sequence TLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein