Cell Biology

The gene DSCR4 (Down syndrome critical region protein-4) is mapped to human chromosome 21q22.2.

DSG2 (Desmoglein 2) is a transmembrane glycoprotein belonging to the family of Ca(2+) dependent cell adhesion molecules, the cadherins. It is a largest protein of the cadherin family with a molecular weight of 116,760.

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Kinetochore-associated protein DSN1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to DSN1 homolog, MIS12 kinetochore complex component Sequence LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ Application All

DST gene encodes dystonin, a cytoskeletal linker protein. Dystonin proteins are present as several isoforms in neural and muscle cells.

Immunogen denticleless homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the C terminal region of human DTX2 Biochem/physiol Actions DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate

Immunogen deltex 2, E3 ubiquitin ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in