Cell Biology

Immunogen Recombinant protein corresponding to E2F transcription factor 3 Sequence MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen E2F transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human E2F4 Application Rabbit Anti-E2F4 antibody can be used for western blot (2.0&#956g/ml) and IHC (4-8&#956g/ml) applications.

Immunogen E2F transcription factor 4, p107/p130-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen E2F transcription factor 5, p130-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen E2F transcription factor 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to E2F transcription factor 6 Sequence AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated

Immunogen E2F transcription factor 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

E6AP/UB3A is an interesting E3 ubiquitin protein ligase with newly discovered alternative functions as well. It is the founding member of the HECT (Homologous to E6AP C terminus) family of ubiquitin ligases and recent research is shedding new light

E6AP is an E3 ubiquitin ligase that is expressed by the UB3A gene. Inhibiton or alterations of the UB3A gene may cause a neurological disorder called the Angelman Syndrome.

Immunogen ELL associated factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the