-
Add to Cart The item has been addedHPA069538-100ULAnti-EAF1 antibody produced in rabbit (C15-1465-695)
Price: $928.29List Price: $1,031.43Immunogen ELL associated factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA008411-100ULAnti-EAF2 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene encoding ELL-associated factor 2 (EAF2) is localized on human chromosome 3q13.33. -
Add to Cart The item has been addedE3906-200ULAnti-Early Endosomal Antigen 1 (C-terminal) antibody produced in rabbit
Price: $948.00List Price: $1,053.33Anti-Early Endosomal Antigen 1 (C-terminal), is produced in rabbit using a synthetic peptide corresponding to amino acid residues 1391-1410 of human EEA1, conjugated to keyhole limpet hemocyanin (KLH), as immunogen. Early Endosomal Antigen 1 (EEA1) -
Add to Cart The item has been addedE4156-200ULAnti-Early Endosomal Antigen 1 (N-terminal) antibody produced in rabbit
Price: $951.43List Price: $1,057.14The gene Early Endosome Antigen 1 (EEA1) encodes for around 1400 amino acid proteins. It is a peripheral membrane protein associated with the cytoplasmic face of early endosomes. -
Add to Cart The item has been addedHPA026512-100ULAnti-EBNA1BP2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Probable rRNA-processing protein EBP2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedABE43Anti-Ebp1 NT Antibody (C15-1317-154)
Price: $759.43List Price: $843.81Ebp1 is an RNA-binding protein involved in growth regulation. In cancer cells, this protein and has been implicated in growth inhibition and differentiation. -
Add to Cart The item has been addedAV45699-100ULAnti-ECHS1 (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81ECHS1 (Enoyl CoA hydratase, short chain, 1, mitochondrial) is structurally located in chromosome 10q26.2-q26. -
Add to Cart The item has been addedAV45700-100ULAnti-ECHS1 (AB2) antibody produced in rabbit
Price: $759.43List Price: $843.81ECHS1 (Enoyl CoA hydratase, short chain, 1, mitochondrial) is structurally located in chromosome 10q26.2-q26. -
Add to Cart The item has been addedHPA042979-100ULAnti-ECSIT antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ECSIT homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA036363-100ULAnti-ECT2 antibody produced in rabbit (C15-1454-317)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to epithelial cell transforming 2 Sequence SLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPH Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA053261-100ULAnti-ECT2 antibody produced in rabbit (C15-1461-282)
Price: $928.29List Price: $1,031.43Immunogen epithelial cell transforming 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA028459-100ULAnti-EDN2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen endothelin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
