Cell Biology

Immunogen EF-hand calcium-binding domain-containing protein 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen EF-hand domain (C-terminal) containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen elongation factor like GTPase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen elongation factor Tu GTP binding domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen elongation factor like GTPase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen EGF-like-domain, multiple 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to EGF like domain multiple 7 Sequence RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD Application All Prestige Antibodies Powered by Atlas Antibodies are

EGF-like-domain, multiple 8 (EGFL8), an EGFL7 paralog, is downregulated in metastatic colorectal cancers (CRC) making it a potential prognostic marker for poor prognosis in CRC and advanced gastric cancer. Specificity Anti-EGFL8 polyclonal antibody

Immunogen EGF-like-domain, multiple 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen EGF like, fibronectin type III and laminin G domains Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Immunogen Sequence: GI # 29725609 , sequence 1091-1210 Recombinant epidermal growth factor receptor isoform a Application Anti-EGFR antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue

Included Negative Control: Catalog # 16-240, Alexa Fluor &#8482 488-conjugated Normal Mouse IgG. Inhibits A431 cell growth.