Cell Biology

Immunogen ELAV like RNA binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to ELAV like RNA binding protein 4 Sequence VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen ETS domain-containing protein Elk-3 recombinant protein epitope signature tag (PrEST) Application Anti-ELK3 antibody produced in rabbit is suitable for use to locate ELK3 DNA binding sites on a genome wide scale by a chromatin

Immunogen elongation factor RNA polymerase II recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Elongation factor for RNA polymerase II 3 (ELL3) is specific for testis and belongs to eleven nineteen lysine-rich leukemia (ELL) protein family. It encodes a 50 kDa protein, with a catalytic domain in N-terminus.

Immunogen elongation factor for RNA polymerase II 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene ELMO2 (engulfment and cell motility protein 2) is mapped to human chromosome 20q13.12.

Elastin (ELN) is a non-soluble protein. The highly durable protein is a major component of the extracellular matrix and is an intrinsic indicator of pathologic states.

Immunogen elastin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen elongin A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen elongin A2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most