Cell Biology

Immunogen ER membrane protein complex subunit 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ER membrane protein complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen ER membrane protein complex subunit 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

EMC7 (Endoplasmic reticulum membrane protein complex subunit 7) is a cytosolic protein, which is composed of an ATP/GTP-binding domain and a leader peptide in its N-terminal. It is an uncharacterized protein.

Immunogen ER membrane protein complex subunit 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen EMILIN-1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-EMILIN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested

Immunogen Recombinant protein corresponding to elastin microfibril interfacer 2 Sequence RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen elastin microfibril interfacer 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen elastin microfibril interfacer 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen elastin microfibril interfacer 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen echinoderm microtubule associated protein like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Echinoderm microtubule-associated protein-like 2 (EML2) is a 70kDa protein which contains a hydrophobic ELP (HELP) domain and a large tryptophan-aspartic acid (WD) repeat domain. The gene encoding it is present on chromosome 19.