Cell Biology

Immunogen EPPIN-WFDC6 readthrough Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Eps15, also known as Epidermal growth factor receptor substrate 15, Protein AF-1p, and encoded by the gene EPS15/AF1P, is an important protein involved in cell growth regulation, cell spreading, proliferation, invagination and budding. Epidermal

Epidermal growth factor receptor substrate 15 (EPS15) localizes to the clathrin-coated pits at the plasma membrane. It contains three N-terminal EPS15 homology (EH) domains, an intermediate coiled-coil domain and a binding domain at the C-terminal

Immunogen Recombinant protein corresponding to epidermal growth factor receptor pathway substrate 15 Sequence DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL Application All Prestige Antibodies Powered by Atlas

The gene EPS15L1 (epidermal growth factor receptor substrate 15-like 1) is mapped to human chromosome 19p13.11.

Immunogen epidermal growth factor receptor pathway substrate 15-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen EPS8-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen EPS8-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

EPSTI1 (epithelial stromal interaction 1) is a putative 307 amino acid stromal fibroblast-induced protein located to chromosome 13q13.3.

The gene ERAL1 (ERA-like protein 1) is mapped to human chromosome 17q11.2.

Immunogen GTP-binding protein era homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen endoplasmic reticulum aminopeptidase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive