Cell Biology

Anti Factor IX antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the HIX-1 hybridoma produced by the fusion of mouse Sp2/0-Ag14 myeloma cells and splenocytes from BALB/c mice immunized with factor IX purified from human plasma. Factor

Anti-FADD antibody, Mouse monoclonal (mouse IgG1) is derived from the FD19 hybridoma produced by the fusion of murine myeloma cells (NS1) and splenocytes from mouse immunized with purified recombinant human FADD. Immunogen purified recombinant

Immunogen fatty acid desaturase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen fatty acid desaturase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen fatty acid desaturase domain family, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Fas-associated protein 1 (FAF1) is a member of the TNF receptor superfamily that plays a critical role in apoptosis during development and immune function. FAF1 has two amino-terminal domains with structural homology to ubiquitin.

Immunogen Fas associated factor family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to Fas associated factor family member 2 Sequence EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Fas associated factor family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Fumarylacetoacetate hydrolase (FAH) is encoded by the gene mapped to human chromosome 15q25.1.

Immunogen fumarylacetoacetate hydrolase (fumarylacetoacetase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen fumarylacetoacetate hydrolase domain containing 2A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive