-
HPA035455-100UL
Anti-FAM217A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Uncharacterized protein C6orf146 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041021-100UL
Anti-FAM217B antibody produced in rabbit (C15-1456-480)
Price: $928.29List Price: $1,031.43Immunogen chromosome 20 open reading frame 177 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA056698-100UL
Anti-FAM217B antibody produced in rabbit (C15-1462-425)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 217, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA019338-100UL
Anti-FAM219A antibody produced in rabbit (C15-1449-280)
Price: $879.43List Price: $977.14The gene FAM219A (C9orf25) is mapped to human chromosome 9q. Immunogen Uncharacterized protein C9orf25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA052909-100UL
Anti-FAM219A antibody produced in rabbit (C15-1461-177)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 219, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA048929-100UL
Anti-FAM219B antibody produced in rabbit (C15-1459-753)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 219, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA058064-100UL
Anti-FAM219B antibody produced in rabbit (C15-1462-816)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 219, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA040181-100UL
Anti-FAM222A antibody produced in rabbit (C15-1456-095)
Price: $928.29List Price: $1,031.43Immunogen chromosome 12 open reading frame 34 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA058774-100UL
ANTI-FAM222A ANTIBODY PRODUCED IN RABBIT (C15-1463-049)
Price: $977.14List Price: $1,085.71Immunogen family with sequence similarity 222 member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA071871-100UL
Anti-FAM234A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to family with sequence similarity 234 member A Sequence REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM Application All Prestige Antibodies Powered by Atlas -
HPA010850-100UL
Anti-FAM234B antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to family with sequence similarity 234 member B Sequence DLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVR Application All -
HPA073342-100UL
ANTI-FAM240C ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen FAM240C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human