Cell Biology

Immunogen Fli-1 proto-oncogene, ETS transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mammalian homolog of drosophila flightless-1 is encoded by the FLII gene in human (also known as FLI, Fli1, or FLIL). The human flightless-1 homolog (Flii) contains sixteen 23-amino acid leucine-rich repeats (LRR) in its N-terminal half and a

In human Viral FLICE-inhibitory proteins (v-FLIPs) is identified as c-FLIP. It is composed of two death effector domains which have structural resemblance with the N-terminal half of caspase-8 and a caspase-like domain.

Immunogen Synthetic peptide directed towards the N terminal region of human FLJ14213 Sequence Synthetic peptide located within the following region: SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ Physical form Purified antibody supplied in 1x

FLJ37300 is a Kinesin-like protein also known as KIF19. It has a molecular weight of 111 kDa and is expressed with the cytoskeleton.

Flotillin-2 is a protein encoded by the FLOT2 gene in humans. Flotillin 2 is more widely distributed, but is absent in skeletal muscle.

FLT3 (Fms-like tyrosine kinase) is a member of the tyrosine kinase (RTK) family. It has an extracellular domain consisting of five immunoglobulin-like domains and an intracellular kinase domain interrupted by a kinase insert.

Immunogen Recombinant protein corresponding to fms related tyrosine kinase 4 Sequence LEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLH Application All

Immunogen Recombinant protein corresponding to fms related tyrosine kinase 4 Sequence LQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYK Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen fms related tyrosine kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Fluorescent Gold (hydroxystilbamidine), better known as Fluorogold, has been a very popular fluorescent marker used to retrogradely label projection neurons. AB153 also reacts with aminostilbamidine quite nicely in frozen, 4% PFA fixed tissues.

Immunogen feline leukemia virus subgroup C cellular receptor family, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas