Cell Biology

Immunogen folliculin interacting protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to folliculin interacting protein 2 Sequence GFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

The gene farnesyltransferase/geranylgeranyltransferase type-1 subunit &#945 (FNTA) is mapped to human chromosome 8. The protein localizes in the cytoplasm.

The gene C-FOS (Cellular oncogene fos) is mapped to human chromosome 14q24.3.

Immunogen FOS like 1, AP-1 transcription factor subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen FOS-like antigen 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Fos-related antigen 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen FOS-like antigen 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Forkhead box protein C1 (FOXC1) is a member of the family of forkhead transcription factors. These proteins are characterized by the forkhead domain--a 110 amino acid domain that binds to DNA molecules.

FOXC2 belongs to the forkhead transcription factor family and has a distinct DNA-binding forkhead domain. Increased expression of FOXC2 is known to prevent hypertriglyceridemia and insulin resistance induced by diet.

FOXF1 is a transcription factor that is induced upon p53-dependent DNA damage. Studies have reported that this transcription factor may act as a p53 target.

FoxF2 is a forkhead transcription factor that is expressed in mesodermal tissues. This transcription factor is involved in epithelio-mesenchymal crosstalk.