-
HPA030479-100UL
Anti-FRK antibody produced in rabbit (C15-1452-714)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to fyn related Src family tyrosine kinase Sequence RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA072590-100UL
ANTI-FRK ANTIBODY PRODUCED IN RABBIT (C15-1466-240)
Price: $977.14List Price: $1,085.71Immunogen fyn related Src family tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA030347-100UL
Anti-FRMD1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen FERM domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA017285-100UL
Anti-FRMD3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen FERM domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038449-100UL
Anti-FRMD4A antibody produced in rabbit
Price: $928.29List Price: $1,031.43FERM domain containing 4A (FRMD4A) is a member of the four-point-one, ezrin, radixin, moesin (FERM) superfamily of proteins. As the name suggests, the protein contains FERM domain, which is implicated in linking transmembrane proteins to the -
HPA009705-100UL
Anti-FRMD4B antibody produced in rabbit
Price: $879.43List Price: $977.14FRMD4B (FERM domain containing 4B) is a highly polymorphic gene localized to human chromosome 3p14.1 and is composed of 24 exons. -
HPA011746-100UL
Anti-FRMD5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen FERM domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA002861-100UL
Anti-FRMD8 antibody produced in rabbit (C15-1445-679)
Price: $879.43List Price: $977.14Immunogen FERM domain-containing protein 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA005506-100UL
Anti-FRMD8 antibody produced in rabbit (C15-1446-372)
Price: $879.43List Price: $977.14Immunogen FERM domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042934-100UL
Anti-FRMPD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen FERM and PDZ domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA003164-100UL
Anti-FRMPD3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen FERM and PDZ domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA017883-100UL
Anti-FRRS1 antibody produced in rabbit
Price: $879.43List Price: $977.14Ferric-chelate reductase 1 (FRRS1) is expressed in the brain. Immunogen Ferric-chelate reductase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the