-
HPA069609-100UL
Anti-GDF11 antibody produced in rabbit (C15-1465-711)
Price: $928.29List Price: $1,031.43Immunogen growth differentiation factor 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA011191-100UL
Anti-GDF15 antibody produced in rabbit (C15-1447-555)
Price: $879.43List Price: $977.14GDF15 (growth differentiation factor 15) is a part of the transforming growth factor-β (TGFβ) or bone morphogenetic protein (BMP) superfamily. This gene resides in human chromosomal locus 19p12. -
HPA070957-100UL
Anti-GDF15 antibody produced in rabbit (C15-1465-936)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to growth differentiation factor 15 Sequence EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA018468-100UL
Anti-GDF3 antibody produced in rabbit
Price: $879.43List Price: $977.14The growth differentiation factor-3 (GDF3) gene is mapped to human chromosome 12p13.1. -
HPA015648-100UL
Anti-GDF5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Growth/differentiation factor 5 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA045206-100UL
Anti-GDF6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen growth differentiation factor 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA049290-100UL
Anti-GDI1 antibody produced in rabbit (C15-1459-885)
Price: $928.29List Price: $1,031.43Immunogen GDP dissociation inhibitor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA057668-100UL
Anti-GDI1 antibody produced in rabbit (C15-1462-728)
Price: $928.29List Price: $1,031.43Immunogen GDP dissociation inhibitor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA041148-100UL
Anti-GDPD3 antibody produced in rabbit (C15-1456-551)
Price: $928.29List Price: $1,031.43Immunogen glycerophosphodiester phosphodiesterase domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA041470-100UL
Anti-GDPD3 antibody produced in rabbit (C15-1456-715)
Price: $928.29List Price: $1,031.43Glycerophosphodiester phosphodiesterase domain containing 3 (GDPD3), also known as glycerophosphodiester phosphodiesterase 7 (GDE7), is encoded by the gene mapped to human chromosome 16p11-q21. Immunogen glycerophosphodiester phosphodiesterase -
HPA065257-100UL
Anti-GDPD5 antibody produced in rabbit (C15-1464-843)
Price: $928.29List Price: $1,031.43Immunogen glycerophosphodiester phosphodiesterase domain containing 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA066762-100UL
Anti-GDPD5 antibody produced in rabbit (C15-1465-140)
Price: $928.29List Price: $1,031.43Immunogen glycerophosphodiester phosphodiesterase domain containing 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most