-
HPA013339-100UL
Anti-GGT7 antibody produced in rabbit (C15-1447-955)
Price: $879.43List Price: $977.14Immunogen gamma-glutamyltransferase 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA044348-100UL
Anti-GID4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 17 open reading frame 39 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA044887-100UL
Anti-GIMAP1 antibody produced in rabbit (C15-1458-323)
Price: $928.29List Price: $1,031.43Immunogen GTPase, IMAP family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA053441-100UL
Anti-GIMAP1 antibody produced in rabbit (C15-1461-338)
Price: $928.29List Price: $1,031.43Immunogen GTPase, IMAP family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA013589-100UL
Anti-GIMAP2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen GTPase IMAP family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA019135-100UL
Anti-GIMAP4 antibody produced in rabbit (C15-1449-228)
Price: $879.43List Price: $977.14The gene GIMAP4 (GTPase IMAP family member 4) is mapped to human chromosome 7q36. It belongs to GIMAP family of proteins. -
HPA019137-100UL
Anti-GIMAP4 antibody produced in rabbit (C15-1449-230)
Price: $879.43List Price: $977.14The gene GIMAP4 (GTPase IMAP family member 4) is mapped to human chromosome 7q36. It belongs to GIMAP family of proteins. -
HPA027198-100UL
Anti-GIMAP4 antibody produced in rabbit (C15-1451-361)
Price: $879.43List Price: $977.14Immunogen GTPase, IMAP family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA026715-100UL
Anti-GIMAP6 antibody produced in rabbit (C15-1451-170)
Price: $879.43List Price: $977.14Immunogen GTPase IMAP family member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050740-100UL
Anti-GIMAP6 antibody produced in rabbit (C15-1460-398)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to GTPase, IMAP family member 6. Sequence SLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQK Application All Prestige Antibodies Powered by Atlas -
HPA020266-100UL
Anti-GIMAP7 antibody produced in rabbit (C15-1449-555)
Price: $879.43List Price: $977.14GTPase IMAP family member 7 (GIMAP7) belongs to the GTPases of immunity-associated proteins (GIMAPs) family. It is localized to the Golgi apparatus and endoplasmic reticulum. -
HPA020268-100UL
Anti-GIMAP7 antibody produced in rabbit (C15-1449-556)
Price: $879.43List Price: $977.14GTPase IMAP family member 7 (GIMAP7) belongs to the GTPases of immunity-associated proteins (GIMAPs) family. It is localized to the Golgi apparatus and endoplasmic reticulum.