-
Add to Cart The item has been addedHPA035097-100ULAnti-GJA1 antibody produced in rabbit (C15-1453-689)
Price: $928.29List Price: $1,031.43Immunogen gap junction protein, alpha 1, 43kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047551-100ULAnti-GJA1 antibody produced in rabbit (C15-1459-271)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to gap junction protein alpha 1 Sequence GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA014821-100ULAnti-GJA3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen gap junction protein, alpha 3, 46kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047981-100ULAnti-GJA4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen gap junction protein, alpha 4, 37kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071370-100ULANTI-GJA5 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen gap junction protein alpha 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA014715-100ULAnti-GJA8 antibody produced in rabbit (C15-1448-217)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to gap junction protein alpha 8 Sequence SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP Application All -
Add to Cart The item has been addedHPA062940-100ULAnti-GJA8 antibody produced in rabbit (C15-1464-240)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to gap junction protein alpha 8 Sequence VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA067850-100ULAnti-GJA9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen gap junction protein, alpha 9, 59kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV36608-100ULAnti-GJB2 antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human GJB2 Biochem/physiol Actions GJB2 also known as connexin 26 is a gap junction protein that belongs to the connexin family. It is a component of the gap junctions between -
Add to Cart The item has been addedHPA074472-100ULAnti-GJB3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen gap junction protein, beta 3, 31kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA055112-100ULAnti-GJB4 antibody produced in rabbit (C15-1461-892)
Price: $977.14List Price: $1,085.71Immunogen gap junction protein, beta 4, 30.3kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA073904-100ULANTI-GJB4 ANTIBODY PRODUCED IN RABBIT (C15-1466-456)
Price: $977.14List Price: $1,085.71Immunogen gap junction protein beta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
