Cell Biology

Immunogen Recombinant protein corresponding to insulin like growth factor binding protein 5 Sequence DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Insulin-like growth factor-binding protein 6 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Insulin-like growth factor binding protein 7 (IGFBP7) is a protein that strongly binds to IGF-I and with low affinity to IGF-II. It is known to mediate cell adhesion and the production of prostacyclin.

Insulin-like growth factor binding protein 7 (IGFBP7) belongs to the IGFBP family. It is widely distributed in normal tissues but less available in the cancerous cells.

Immunogen IGF-like family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen IGF-like family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen IGF-like family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen immunoglobulin-like and fibronectin type III domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen immunoglobulin mu binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen IgA-inducing protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen IgA-inducing protein homolog (Bos taurus) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

IGPR-1 or Immunoglobulin and proline-rich receptor 1, also called Transmembrane and immunoglobulin domain-containing protein 2 and encoded by the human gene TMIGD2/IGPR1 is a widely expressed epithelial and endothelial membrane protein that plays a