-
HPA029561-100UL
Anti-IMPA2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen inositol(myo)-1(or 4)-monophosphatase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA041045-100UL
Anti-IMPACT antibody produced in rabbit (C15-1456-495)
Price: $967.37List Price: $1,074.86Immunogen Impact homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA041968-100UL
Anti-IMPACT antibody produced in rabbit (C15-1456-989)
Price: $928.29List Price: $1,031.43Impact RWD domain protein (IMPACT) is expressed highly in brain. The gene is located on human chromosome 18q11. -
HPA008779-100UL
Anti-IMPG2 antibody produced in rabbit (C15-1447-216)
Price: $977.14List Price: $1,085.71Immunogen interphotoreceptor matrix proteoglycan 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA015907-100UL
Anti-IMPG2 antibody produced in rabbit (C15-1448-472)
Price: $977.14List Price: $1,085.71Immunogen interphotoreceptor matrix proteoglycan 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA052591-100UL
Anti-ING1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen inhibitor of growth family, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067388-100UL
Anti-ING3 antibody produced in rabbit (C15-1465-287)
Price: $928.29List Price: $1,031.43Immunogen inhibitor of growth family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067575-100UL
Anti-ING3 antibody produced in rabbit (C15-1465-334)
Price: $928.29List Price: $1,031.43Immunogen inhibitor of growth family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA042685-100UL
Anti-ING5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen inhibitor of growth family, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA061343-100UL
Anti-INMT antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen indolethylamine N-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA070644-100UL
Anti-INO80B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to INO80 complex subunit B Sequence GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
ABN26
Anti-iNOS/NOS II Antibody, NT (C15-1317-524)
Price: $918.86List Price: $1,020.95Nitric oxide (NO) is an inorganic, gaseous free radical that carries a variety of messages between cells. Vasorelaxation, neurotransmission and cytotoxicity can all be potentiated through cellular response to NO.