-
HPA046181-100UL
ANTI-INTS5 ANTIBODY PRODUCED IN RABBIT (C15-1458-761)
Price: $977.14List Price: $1,085.71Immunogen integrator complex subunit 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA056915-100UL
Anti-INTS5 antibody produced in rabbit (C15-1462-495)
Price: $928.29List Price: $1,031.43Immunogen integrator complex subunit 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA001552-100UL
Anti-INTS6 antibody produced in rabbit (C15-1445-331)
Price: $879.43List Price: $977.14Immunogen Integrator complex subunit 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA001846-100UL
Anti-INTS6 antibody produced in rabbit (C15-1445-438)
Price: $879.43List Price: $977.14Immunogen Integrator complex subunit 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA013200-100UL
Anti-INTS6L antibody produced in rabbit (C15-1447-937)
Price: $879.43List Price: $977.14Immunogen integrator complex subunit 6 like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA013335-100UL
Anti-INTS6L antibody produced in rabbit (C15-1447-953)
Price: $879.43List Price: $977.14DDX26B (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B) gene encodes a human DEAD-box RNA helicase that is ATP-dependent. The DDX26 gene consists of 14 exons spanning a length of 8,123bp of genomic sequence. -
HPA030747-100UL
Anti-INTS6L antibody produced in rabbit (C15-1452-816)
Price: $879.43List Price: $977.14Immunogen integrator complex subunit 6 like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA072611-100UL
Anti-INTS7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to integrator complex subunit 7 Sequence GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA Application All Prestige Antibodies Powered by Atlas Antibodies are -
AB9074
Anti-IP3 Receptor 2 Antibody (C15-1316-462)
Price: $759.43List Price: $843.81Specificity IP3 Receptor 2. Immunogen Synthetic peptide from the C terminus of human IP3 Receptor 2. -
HPA040825-100UL
Anti-IP6K1 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Inositol hexakisphosphate kinase (IP6K1) is encoded by the gene mapped to human chromosome 3p21.31. -
HPA007532-100UL
Anti-IP6K2 antibody produced in rabbit (C15-1446-913)
Price: $879.43List Price: $977.14IP6K2 (inositol hexakisphosphate kinase 2) gene is mapped to human chromosome 3p21.31. -
HPA070811-100UL
Anti-IP6K2 antibody produced in rabbit (C15-1465-916)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to inositol hexakisphosphate kinase 2 Sequence RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and