-
HPA052646-100UL
Anti-JPH2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen junctophilin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA052675-100UL
Anti-JRK antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Jrk helix-turn-helix protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046184-100UL
Anti-JRKL antibody produced in rabbit (C15-1458-764)
Price: $928.29List Price: $1,031.43Immunogen JRK-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA060341-100UL
Anti-JRKL antibody produced in rabbit (C15-1463-510)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to JRK-like Sequence RFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA006514-100UL
Anti-JTB antibody produced in rabbit
Price: $879.43List Price: $977.14JTB (jumping translocation breakpoint) is a highly conserved transmembrane protein, and the gene to this protein is localized to human chromosome 1q21. This gene has four introns and five exons. -
HPA031174-100UL
ANTI-JUN ANTIBODY PRODUCED IN RABBIT (C15-1453-012)
Price: $977.14List Price: $1,085.71Immunogen Jun proto-oncogene, AP-1 transcription factor subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA059474-100UL
Anti-JUN antibody produced in rabbit (C15-1463-275)
Price: $928.29List Price: $1,031.43Immunogen jun proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA019149-100UL
Anti-JUNB antibody produced in rabbit
Price: $879.43List Price: $977.14The gene JUNB (Jun B proto-oncogene) is mapped to human chromosome 19p13.2. -
HPA063029-100UL
Anti-JUND antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen jun D proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA000452-100UL
Anti-JUP antibody produced in rabbit (C15-1444-948)
Price: $879.43List Price: $977.14Immunogen Keratin 17, type I recombinant protein epitope signature tag (PrEST). Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA000453-100UL
Anti-JUP antibody produced in rabbit (C15-1444-949)
Price: $879.43List Price: $977.14Immunogen Keratin, type I cytoskeletal 17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA032047-100UL
Anti-JUP antibody produced in rabbit (C15-1453-355)
Price: $889.20List Price: $988.00Immunogen junction plakoglobin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the