-
Add to Cart The item has been addedHPA048301-100ULAnti-ALS2CL antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ALS2 C-terminal like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA035793-100ULAnti-ALS2CR12 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedFCMAB327FAnti-Alzheimer Precursor Protein A4 (NT)-FITC Antibody, clone 22C11
Price: $713.14List Price: $792.38Deposits of amyloid protein in senile plaques near nerve processes are found in the brains of aged humand and cases of Alzheimer′s Disease. The principle component of this extracellular amyloid is beta A4, a 4 kDa peptide derived from a -
Add to Cart The item has been addedHPA001497-100ULAnti-AMBP antibody produced in rabbit (C15-1445-306)
Price: $879.43List Price: $977.14Immunogen Protein AMBP precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA075585-100ULANTI-AMBP ANTIBODY PRODUCED IN RABBIT (C15-1466-757)
Price: $977.14List Price: $1,085.71Immunogen alpha-1-microglobulin/bikunin precursor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA029281-100ULAnti-AMD1 antibody produced in rabbit (C15-1452-202)
Price: $879.43List Price: $977.14Immunogen adenosylmethionine decarboxylase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA029282-100ULAnti-AMD1 antibody produced in rabbit (C15-1452-203)
Price: $879.43List Price: $977.14Immunogen adenosylmethionine decarboxylase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA039720-100ULAnti-AMDHD1 antibody produced in rabbit (C15-1455-868)
Price: $928.29List Price: $1,031.43Immunogen amidohydrolase domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA040149-100ULANTI-AMDHD1 ANTIBODY PRODUCED IN RABBIT (C15-1456-081)
Price: $977.14List Price: $1,085.71Immunogen amidohydrolase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA065214-100ULAnti-AMER1 antibody produced in rabbit (C15-1464-830)
Price: $928.29List Price: $1,031.43Immunogen APC membrane recruitment protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA065265-100ULAnti-AMER1 antibody produced in rabbit (C15-1464-846)
Price: $928.29List Price: $1,031.43Immunogen APC membrane recruitment protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA066973-100ULAnti-AMH antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to anti-Mullerian hormone Sequence GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
