Cell Biology

Mitochondrial ribonuclease P protein 3 (MRPP3) is a subunit of mitochondrial-RNase P complex, with RNA-binding and metallonuclease domains. It belongs to the pentatricopeptide repeat (PPR) domain protein family.

Immunogen KIAA0408 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to KIAA0408 Sequence DWRPSNLSGRPRSADPRSNYGVVEKLLKTYETATESALQNSKCFQDNWTKCNSDVSGGATLSQHLEMLQMEQQFQQKTAVWGGQEVKQGI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

The gene KIAA0430 is also referred as LKAP (Limkain-b1). LKAP is suggested to be an RNA-binding protein.

Uncharacterized protein KIAA0513 is ubiquitously expressed with strong expression in the brain, mainly the cerebellum. Immunogen Uncharacterized protein KIAA0513 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies

Immunogen Uncharacterized protein KIAA0513 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

KIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas

KIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas

Uncharacterized protein KIAA0825 is mapped to human chromosome 5. Immunogen Uncharacterized protein KIAA0825 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen KIAA0825 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human