-
HPA049512-100UL
Anti-KLF3 antibody produced in rabbit (C15-1459-984)
Price: $928.29List Price: $1,031.43Immunogen Kruppel-like factor 3 (basic) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA065054-100UL
Anti-KLF3 antibody produced in rabbit (C15-1464-805)
Price: $928.29List Price: $1,031.43Immunogen Kruppel-like factor 3 (basic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
AB4138
Anti-KLF4 Antibody (C15-1316-148)
Price: $759.43List Price: $843.81Specificity Recognizes KLF4. The calculated molecular weight is ~50. -
HPA002926-100UL
Anti-KLF4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Krueppel-like factor 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA069585-100UL
Anti-KLF6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Kruppel-like factor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA020119-100UL
Anti-KLHDC10 antibody produced in rabbit
Price: $879.43List Price: $977.14Kelch domain-containing protein 10 (KLHDC10) possesses kelch motifs. Immunogen Kelch domain-containing protein 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA000628-100UL
Anti-KLHDC2 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene KLHDC2 is localized to chromosome 14q21.3 along with KLHDC1 and is predominantly found in the nucleus. -
HPA030131-100UL
Anti-KLHDC3 antibody produced in rabbit (C15-1452-548)
Price: $879.43List Price: $977.14Immunogen kelch domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA030132-100UL
Anti-KLHDC3 antibody produced in rabbit (C15-1452-549)
Price: $879.43List Price: $977.14Immunogen kelch domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA030133-100UL
Anti-KLHDC3 antibody produced in rabbit (C15-1452-550)
Price: $879.43List Price: $977.14Immunogen kelch domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA030134-100UL
Anti-KLHDC3 antibody produced in rabbit (C15-1452-551)
Price: $879.43List Price: $977.14Immunogen kelch domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA008463-100UL
Anti-KLHDC8B antibody produced in rabbit (C15-1447-150)
Price: $879.43List Price: $977.14Immunogen Kelch domain-containing protein 8B recombinant protein epitope signature tag (PrEST) Sequence GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALG Application All Prestige