-
HPA077907-100UL
Anti-LUZP6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen leucine zipper protein 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA024755-100UL
Anti-LY6D antibody produced in rabbit (C15-1450-878)
Price: $977.14List Price: $1,085.71The gene LY6D (lymphocyte antigen 6 complex, locus D) is mapped to human chromosome 8q24.3. -
HPA064317-100UL
Anti-LY6D antibody produced in rabbit (C15-1464-608)
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 6 complex, locus D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA048307-100UL
Anti-LY6G5B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 6 complex, locus G5B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA038690-100UL
Anti-LY6G5C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Lymphocyte antigen 6 complex locus protein G5c Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA056234-100UL
Anti-LY6G6E antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to lymphocyte antigen 6 family member G6E Sequence VPTECRDDEACGISIGTSGRTLVQWPFSRRLPTSIHPAFPVAPASACLFHPTDQSEITE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA077218-100UL
ANTI-LY6H ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen lymphocyte antigen 6 family member H Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA017770-100UL
Anti-LY6K antibody produced in rabbit
Price: $879.43List Price: $977.14Anti-LY6K antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. -
HPA049108-100UL
Anti-LY75 antibody produced in rabbit (C15-1459-824)
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 75 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA054073-100UL
Anti-LY75 antibody produced in rabbit (C15-1461-557)
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 75 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA044895-100UL
Anti-LY86 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 86 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA050917-100UL
Anti-LY9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by